PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_11250.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 263aa    MW: 30273.4 Da    PI: 7.2169
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_11250.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM100.62.1e-3127356128
                      NAM  56 kewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vls k++++g++ktLv+ykgrap+g+k dW+mheyrl
  Rsa1.0_11250.1_g00001.1   2 SEWYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVLS-KNNVIGMRKTLVYYKGRAPNGRKLDWIMHEYRL 73 
                              69*************************************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.275194IPR003441NAC domain
SuperFamilySSF1019413.53E-36294IPR003441NAC domain
PfamPF023651.3E-14473IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
QSEWYFFSHK DRKYPTGTRT NRATAAGFWK ATGRDKAVLS KNNVIGMRKT LVYYKGRAPN  60
GRKLDWIMHE YRLQNSELAP VQEEGWVVCR AFRKPIPNQR PLGYETWQNQ LHHVDNSNNY  120
SSSATMNTSH HIGASSSSQN FNQMVMSNNH YNANNPSSMM HQYGNIELPQ LDSPSLSPSL  180
GTNKDHNESL EQEEEKSFNY VDWRTLDSLL DIQVTHPQNP NVLVSSLAMQ SYNPEQSFPS  240
MHQNYNYEVE ANIHHSLGFF PDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-2919470165NO APICAL MERISTEM PROTEIN
1ut4_B6e-2919470165NO APICAL MERISTEM PROTEIN
1ut7_A6e-2919470165NO APICAL MERISTEM PROTEIN
1ut7_B6e-2919470165NO APICAL MERISTEM PROTEIN
3swm_A8e-2919473168NAC domain-containing protein 19
3swm_B8e-2919473168NAC domain-containing protein 19
3swm_C8e-2919473168NAC domain-containing protein 19
3swm_D8e-2919473168NAC domain-containing protein 19
3swp_A8e-2919473168NAC domain-containing protein 19
3swp_B8e-2919473168NAC domain-containing protein 19
3swp_C8e-2919473168NAC domain-containing protein 19
3swp_D8e-2919473168NAC domain-containing protein 19
4dul_A6e-2919470165NAC domain-containing protein 19
4dul_B6e-2919470165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0854240.0AY085424.1 Arabidopsis thaliana clone 151034 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013717628.10.0PREDICTED: NAC domain-containing protein 30-like
SwissprotQ9C8W91e-170NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A078CZD40.0A0A078CZD4_BRANA; BnaC02g20880D protein
STRINGBra007996.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69502744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-148vascular related NAC-domain protein 7